Lineage for d4xxob_ (4xxo B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2525970Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2525977Protein APOBEC3A [310759] (1 species)
  7. 2525978Species Human (Homo sapiens) [TaxId:9606] [311014] (2 PDB entries)
  8. 2525980Domain d4xxob_: 4xxo B: [310087]
    complexed with cl, zn

Details for d4xxob_

PDB Entry: 4xxo (more details), 2.84 Å

PDB Description: crystal structure of human apobec3a
PDB Compounds: (B:) DNA dC->dU-editing enzyme APOBEC-3A

SCOPe Domain Sequences for d4xxob_:

Sequence, based on SEQRES records: (download)

>d4xxob_ c.97.1.6 (B:) APOBEC3A {Human (Homo sapiens) [TaxId: 9606]}
gprhlmdphiftsnfnngigrhktylcyeverldngtsvkmdqhrgflhnqaknllcgfy
grhaalrfldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthvrlrifaa
riydydplykealqmlrdagaqvsimtydefkhcwdtfvdhqgapfqpwdgldehsqals
grlrailqn

Sequence, based on observed residues (ATOM records): (download)

>d4xxob_ c.97.1.6 (B:) APOBEC3A {Human (Homo sapiens) [TaxId: 9606]}
gprhlmdphiftsnfnngigrhktylcyeverldntsvkmdqhrgflhnqaknllgfygr
haalrfldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthvrlrifaari
ydydplykealqmlrdagaqvsimtydefkhcwdtfvdhqgapfqpwdgldehsqalsgr
lrailqn

SCOPe Domain Coordinates for d4xxob_:

Click to download the PDB-style file with coordinates for d4xxob_.
(The format of our PDB-style files is described here.)

Timeline for d4xxob_: