Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins) strand 5 is parallel to strand 4 Pfam PF08210; Pfam PF05240 |
Protein APOBEC3A [310759] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [311014] (2 PDB entries) |
Domain d4xxob_: 4xxo B: [310087] complexed with cl, zn |
PDB Entry: 4xxo (more details), 2.84 Å
SCOPe Domain Sequences for d4xxob_:
Sequence, based on SEQRES records: (download)
>d4xxob_ c.97.1.6 (B:) APOBEC3A {Human (Homo sapiens) [TaxId: 9606]} gprhlmdphiftsnfnngigrhktylcyeverldngtsvkmdqhrgflhnqaknllcgfy grhaalrfldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthvrlrifaa riydydplykealqmlrdagaqvsimtydefkhcwdtfvdhqgapfqpwdgldehsqals grlrailqn
>d4xxob_ c.97.1.6 (B:) APOBEC3A {Human (Homo sapiens) [TaxId: 9606]} gprhlmdphiftsnfnngigrhktylcyeverldntsvkmdqhrgflhnqaknllgfygr haalrfldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthvrlrifaari ydydplykealqmlrdagaqvsimtydefkhcwdtfvdhqgapfqpwdgldehsqalsgr lrailqn
Timeline for d4xxob_: