Lineage for d1akz__ (1akz -)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120142Fold c.18: DNA glycosylase [52140] (1 superfamily)
  4. 120143Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 120144Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 120145Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 120164Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries)
  8. 120165Domain d1akz__: 1akz - [31007]

Details for d1akz__

PDB Entry: 1akz (more details), 1.57 Å

PDB Description: human uracil-dna glycosylase

SCOP Domain Sequences for d1akz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akz__ c.18.1.1 (-) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOP Domain Coordinates for d1akz__:

Click to download the PDB-style file with coordinates for d1akz__.
(The format of our PDB-style files is described here.)

Timeline for d1akz__: