Lineage for d1akza1 (1akz A:85-304)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) 
Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) Protein Uracil-DNA glycosylase [52143] (5 species) Species Human (Homo sapiens) [TaxId:9606] [52144] (16 PDB entries) 
Domain d1akza1: 1akz A:85-304 [31007]
Other proteins in same PDB: d1akza2
Details for d1akza1
PDB Entry: 1akz (more details), 1.57 Å
PDB Description: human uracil-dna glycosylase
PDB Compounds: (A:) uracil-DNA glycosylaseSCOPe Domain Sequences for d1akza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akza1 c.18.1.1 (A:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
SCOPe Domain Coordinates for d1akza1:
Click to download the PDB-style file with coordinates for d1akza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1akza1:
- d1akza1 first appeared (with stable ids) in SCOP 1.55, called d1akz__
- d1akza1 appears in SCOPe 2.07
View in 3D
