Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) different families share similar but non-identical metal-binding sites |
Family c.1.15.0: automated matches [191634] (1 protein) not a true family |
Protein automated matches [191168] (5 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [311472] (1 PDB entry) |
Domain d4xkmh_: 4xkm H: [310048] automated match to d1a0ea_ complexed with mn |
PDB Entry: 4xkm (more details), 2.1 Å
SCOPe Domain Sequences for d4xkmh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xkmh_ c.1.15.0 (H:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} keffpgiekikfegkdsknpmafryydaekvingkkmkdwlrfamawwhtlcaeggdqfg ggtkqfpwngnadaiqaakdkmdagfefmqkmgieyycfhdvdlvsegasveeyeanlke ivayakqkqaetgikllwgtanvfgharymngaatnpdfdvvaraavqiknaidatielg genyvfwggregymsllntdqkrekehlaqmltiardyarargfkgtfliepkpmeptkh qydvdtetvigflkahgldkdfkvnievnhatlaghtfehelavavdngmlgsidanrgd yqngwdtdqfpidnyeltqammqiirngglgtggtnfdaktrrnstdledifiahiagmd amaralesaaalldespykkmladryasfdggkgkefedgkltledvvayaktkgepkqt sgkqelyeailnmyc
Timeline for d4xkmh_: