Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species Murine norovirus 1 [TaxId:223997] [311357] (5 PDB entries) |
Domain d4x2vd_: 4x2v D: [309950] Other proteins in same PDB: d4x2vb2 automated match to d2fyqa_ complexed with imd; mutant |
PDB Entry: 4x2v (more details), 2.3 Å
SCOPe Domain Sequences for d4x2vd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x2vd_ b.47.1.4 (D:) automated matches {Murine norovirus 1 [TaxId: 223997]} vsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyfts avrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgmll tgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathg
Timeline for d4x2vd_:
View in 3D Domains from other chains: (mouse over for more information) d4x2va_, d4x2vb1, d4x2vb2, d4x2vc_ |