Lineage for d4x2va_ (4x2v A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2407160Protein automated matches [190384] (21 species)
    not a true protein
  7. 2407240Species Murine norovirus 1 [TaxId:223997] [311357] (5 PDB entries)
  8. 2407243Domain d4x2va_: 4x2v A: [309946]
    Other proteins in same PDB: d4x2vb2
    automated match to d2fyqa_
    complexed with imd; mutant

Details for d4x2va_

PDB Entry: 4x2v (more details), 2.3 Å

PDB Description: crystal structure of the murine norovirus ns6 protease (inactive c139a mutant) with a c-terminal extension to include residue p1 prime of ns7
PDB Compounds: (A:) ns6 protease

SCOPe Domain Sequences for d4x2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x2va_ b.47.1.4 (A:) automated matches {Murine norovirus 1 [TaxId: 223997]}
apvsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyf
tsavrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgm
lltgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathge

SCOPe Domain Coordinates for d4x2va_:

Click to download the PDB-style file with coordinates for d4x2va_.
(The format of our PDB-style files is described here.)

Timeline for d4x2va_: