SCOPe 2.08: Domain d4wlfc1: 4wlf C:24-168

Lineage for d4wlfc1 (4wlf C:24-168)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225056] (8 PDB entries)

8. Domain d4wlfc1: 4wlf C:24-168 [309869]
   Other proteins in same PDB: d4wlfa2, d4wlfb2, d4wlfc2, d4wlfd2
   automated match to d2dfda1
   complexed with lmr, po4

Details for d4wlfc1

PDB Entry: 4wlf, 2.2 Å

PDB Description: crystal structure of l-malate bound mdh2

PDB Compounds: (C:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wlfc1:

Sequence; same for both SEQRES and ATOM records:

>d4wlfc1 c.2.1.5 (C:24-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
vnstipitaevfkkhgvynpnkifg

Timeline for d4wlfc1:

• d4wlfc1 first appeared in SCOPe 2.06
  
• d4wlfc1 appears in SCOPe 2.07