Lineage for d1c2yk_ (1c2y K:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119999Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 120000Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 120001Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 120002Protein Lumazine synthase [52123] (6 species)
  7. 120063Species Spinach (Spinacia oleracea) [TaxId:3562] [52127] (1 PDB entry)
  8. 120074Domain d1c2yk_: 1c2y K: [30982]

Details for d1c2yk_

PDB Entry: 1c2y (more details), 3.3 Å

PDB Description: crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly

SCOP Domain Sequences for d1c2yk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2yk_ c.16.1.1 (K:) Lumazine synthase {Spinach (Spinacia oleracea)}
mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
mdqainraggkagnkgaesaltaiemaslfehhlk

SCOP Domain Coordinates for d1c2yk_:

Click to download the PDB-style file with coordinates for d1c2yk_.
(The format of our PDB-style files is described here.)

Timeline for d1c2yk_: