SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1c2yk_ (1c2y K:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100750Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2100751Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2100752Family c.16.1.1: Lumazine synthase [52122] (2 protein domains)
  6. 2100753Protein Lumazine synthase [52123] (7 species)
  7. 2100890Species Spinach (Spinacia oleracea) [TaxId:3562] [52127] (1 PDB entry)
  8. 2100901Domain d1c2yk_: 1c2y K: [30982]
    complexed with lmz

Details for d1c2yk_

PDB Entry: 1c2y (more details), 3.3 Å

PDB Description: crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
PDB Compounds: (K:) protein (lumazine synthase)

SCOPe Domain Sequences for d1c2yk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2yk_ c.16.1.1 (K:) Lumazine synthase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
mdqainraggkagnkgaesaltaiemaslfehhlk

SCOPe Domain Coordinates for d1c2yk_:

Click to download the PDB-style file with coordinates for d1c2yk_.
(The format of our PDB-style files is described here.)

Timeline for d1c2yk_: