SCOP 1.59: Domain d1rvv4_: 1rvv 4:

Lineage for d1rvv4_ (1rvv 4:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.16: Lumazine synthase [52120] (1 superfamily)

4. Superfamily c.16.1: Lumazine synthase [52121] (1 family)

5. Family c.16.1.1: Lumazine synthase [52122] (1 protein)

6. Protein Lumazine synthase [52123] (6 species)

7. Species Bacillus subtilis [TaxId:1423] [52124] (1 PDB entry)

8. Domain d1rvv4_: 1rvv 4: [30956]

Details for d1rvv4_

PDB Entry: 1rvv, 2.4 Å

PDB Description: synthase/riboflavin synthase complex of bacillus subtilis

SCOP Domain Sequences for d1rvv4_:

Sequence; same for both SEQRES and ATOM records:

>d1rvv4_ c.16.1.1 (4:) Lumazine synthase {Bacillus subtilis}
mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
ieqaieragtkagnkgvdcavsaiemanlnrsfe

Timeline for d1rvv4_:

• d1rvv4_ first appeared (with stable ids) in SCOP 1.55
  
• d1rvv4_ appears in SCOP 1.57
  
• d1rvv4_ appears in SCOP 1.61
  
• d1rvv4_ appears in the current release, SCOPe 2.08