Lineage for d1rvvr_ (1rvv R:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119999Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 120000Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 120001Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 120002Protein Lumazine synthase [52123] (6 species)
  7. 120009Species Bacillus subtilis [TaxId:1423] [52124] (1 PDB entry)
  8. 120031Domain d1rvvr_: 1rvv R: [30944]

Details for d1rvvr_

PDB Entry: 1rvv (more details), 2.4 Å

PDB Description: synthase/riboflavin synthase complex of bacillus subtilis

SCOP Domain Sequences for d1rvvr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvvr_ c.16.1.1 (R:) Lumazine synthase {Bacillus subtilis}
mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
ieqaieragtkagnkgvdcavsaiemanlnrsfe

SCOP Domain Coordinates for d1rvvr_:

Click to download the PDB-style file with coordinates for d1rvvr_.
(The format of our PDB-style files is described here.)

Timeline for d1rvvr_: