SCOPe 2.07: Domain d4rova_: 4rov A:

Lineage for d4rova_ (4rov A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
   strand 5 is parallel to strand 4
   Pfam PF08210; Pfam PF05240

6. Protein automated matches [310855] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311219] (22 PDB entries)

8. Domain d4rova_: 4rov A: [309484]
   automated match to d2nytb_
   complexed with zn

Details for d4rova_

PDB Entry: 4rov, 1.8 Å

PDB Description: the crystal structure of novel apobec3g cd2 head-to-tail dimer suggests the binding mode of full-length apobec3g to hiv-1 ssdna

PDB Compounds: (A:) DNA dC->dU-editing enzyme APOBEC-3G

SCOPe Domain Sequences for d4rova_:

Sequence; same for both SEQRES and ATOM records:

>d4rova_ c.97.1.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rhsmdpptftfnfnnepwvrgrhetylcyevermhndtwvllnqrrgflcnqaphkhgfl
egrhaelcfldvipfwkldldqdyrvtcftswspcfscaqemakfisknkhvslciftar
iyddqgrcqeglrtlaeagakisimtysefkhcwdtfvdhqgcpfqpwdgldehsqdlsg
rlrailqn

Timeline for d4rova_:

• d4rova_ first appeared in SCOPe 2.06
  
• d4rova_ appears in the current release, SCOPe 2.08