Lineage for d4qz2e_ (4qz2 E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2225288Domain d4qz2e_: 4qz2 E: [309104]
    Other proteins in same PDB: d4qz2a_, d4qz2b_, d4qz2c_, d4qz2f_, d4qz2h_, d4qz2i_, d4qz2j_, d4qz2l_, d4qz2m_, d4qz2n_, d4qz2o_, d4qz2p_, d4qz2q_, d4qz2t_, d4qz2v_, d4qz2w_, d4qz2x_, d4qz2z_
    automated match to d4g4sf_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qz2e_

PDB Entry: 4qz2 (more details), 2.7 Å

PDB Description: yCP beta5-M45I mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (E:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d4qz2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qz2e_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d4qz2e_:

Click to download the PDB-style file with coordinates for d4qz2e_.
(The format of our PDB-style files is described here.)

Timeline for d4qz2e_: