Lineage for d1nzya_ (1nzy A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119892Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 119893Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 119929Family c.14.1.3: Crotonase-like [52103] (5 proteins)
  6. 119930Protein 4-Chlorobenzoyl-CoA dehalogenase [52104] (1 species)
  7. 119931Species Pseudomonas sp., strain CBS-3 [TaxId:306] [52105] (2 PDB entries)
  8. 119932Domain d1nzya_: 1nzy A: [30903]

Details for d1nzya_

PDB Entry: 1nzy (more details), 1.8 Å

PDB Description: 4-chlorobenzoyl coenzyme a dehalogenase from pseudomonas sp. strain cbs-3

SCOP Domain Sequences for d1nzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3}
myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
cagfylreipldkgvagvrdhfriaalwwhqmihkiirvkrpvlaaingvaaggglgisl
asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
thphfmpcltrfldghradrpqvelpagv

SCOP Domain Coordinates for d1nzya_:

Click to download the PDB-style file with coordinates for d1nzya_.
(The format of our PDB-style files is described here.)

Timeline for d1nzya_: