Lineage for d1nzya_ (1nzy A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.14: ClpP/crotonase [52095] (1 superfamily) Superfamily c.14.1: ClpP/crotonase [52096] (3 families) 
Family c.14.1.3: Crotonase-like [52103] (4 proteins) 
Protein 4-Chlorobenzoyl-CoA dehalogenase [52104] (1 species) Species Pseudomonas sp., strain CBS-3 [TaxId:306] [52105] (1 PDB entry) 
Domain d1nzya_: 1nzy A: [30903]
Details for d1nzya_
PDB Entry: 1nzy (more details), 1.8 Å
PDB Description: 4-chlorobenzoyl coenzyme a dehalogenase from pseudomonas sp. strain cbs-3
SCOP Domain Sequences for d1nzya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3}
myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
cagfylreipldkgvagvrdhfriaalwwhqmihkiirvkrpvlaaingvaaggglgisl
asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
thphfmpcltrfldghradrpqvelpagv
SCOP Domain Coordinates for d1nzya_:
Click to download the PDB-style file with coordinates for d1nzya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nzya_:
- d1nzya_ appears in SCOP 1.57
- d1nzya_ appears in the current release, SCOPe 2.08
View in 3D
