| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein automated matches [190144] (11 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
| Domain d4qwuh_: 4qwu H: [308983] Other proteins in same PDB: d4qwua_, d4qwuc_, d4qwue_, d4qwui_, d4qwuj_, d4qwuk_, d4qwul_, d4qwun_, d4qwuo_, d4qwuq_, d4qwus_, d4qwuw_, d4qwux_, d4qwuy_, d4qwuz_ automated match to d4r17h_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qwu (more details), 3 Å
SCOPe Domain Sequences for d4qwuh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwuh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d4qwuh_: