Lineage for d1aua_2 (1aua 97-299)
- Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds) 
Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
core: 4 turns of a (beta-alpha)n superhelix
Superfamily c.13.1: C-terminal domain of phosphatidylinositol transfer protein sec14p [52087] (1 family) 
Family c.13.1.1: C-terminal domain of phosphatidylinositol transfer protein sec14p [52088] (1 protein) Protein C-terminal domain of phosphatidylinositol transfer protein sec14p [52089] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52090] (1 PDB entry) 
Domain d1aua_2: 1aua 97-299 [30882]
Other proteins in same PDB: d1aua_1
complexed with bog
Details for d1aua_2
PDB Entry: 1aua (more details), 2.5 Å
PDB Description: phosphatidylinositol transfer protein sec14p from saccharomyces cerevisiae
SCOP Domain Sequences for d1aua_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aua_2 c.13.1.1 (97-299) C-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae)}
ydekpliakfypqyyhktdkdgrpvyfeelgavnlhemnkvtseermlknlvweyesvvq
yrlpacsraaghlvetsctimdlkgisissaysvmsyvreasyisqnyypermgkfyiin
apfgfstafrlfkpfldpvtvskifilgssyqkellkqipaenlpvkfggksevdeskgg
lylsdigpwrdpkyigpegeape
SCOP Domain Coordinates for d1aua_2:
Click to download the PDB-style file with coordinates for d1aua_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aua_2:
- d1aua_2 first appeared (with stable ids) in SCOP 1.55
- d1aua_2 appears in SCOP 1.63
- d1aua_2 appears in SCOP 1.67
- d1aua_2 appears in the current release, SCOPe 2.08, called d1auaa2
View in 3D
