SCOPe 2.08: Domain d1auaa2: 1aua A:97-299

Lineage for d1auaa2 (1aua A:97-299)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families)
   automatically mapped to Pfam PF00650

5. Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins)
   Pfam PF00650

6. Protein C-terminal domain of phosphatidylinositol transfer protein sec14p [52089] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52090] (1 PDB entry)

8. Domain d1auaa2: 1aua A:97-299 [30882]
   Other proteins in same PDB: d1auaa1
   complexed with bog

Details for d1auaa2

PDB Entry: 1aua, 2.5 Å

PDB Description: phosphatidylinositol transfer protein sec14p from saccharomyces cerevisiae

PDB Compounds: (A:) phosphatidylinositol transfer protein sec14p

SCOPe Domain Sequences for d1auaa2:

Sequence; same for both SEQRES and ATOM records:

>d1auaa2 c.13.1.1 (A:97-299) C-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ydekpliakfypqyyhktdkdgrpvyfeelgavnlhemnkvtseermlknlvweyesvvq
yrlpacsraaghlvetsctimdlkgisissaysvmsyvreasyisqnyypermgkfyiin
apfgfstafrlfkpfldpvtvskifilgssyqkellkqipaenlpvkfggksevdeskgg
lylsdigpwrdpkyigpegeape

Timeline for d1auaa2:

• d1auaa2 first appeared (with stable ids) in SCOP 1.55, called d1aua_2
  
• d1auaa2 appears in SCOPe 2.07