![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.3: N-terminal domain of phosphatidylinositol transfer protein sec14p [46938] (1 family) ![]() |
![]() | Family a.5.3.1: N-terminal domain of phosphatidylinositol transfer protein sec14p [46939] (1 protein) |
![]() | Protein N-terminal domain of phosphatidylinositol transfer protein sec14p [46940] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46941] (1 PDB entry) |
![]() | Domain d1aua_1: 1aua 4-96 [16290] Other proteins in same PDB: d1aua_2 complexed with bog |
PDB Entry: 1aua (more details), 2.5 Å
SCOP Domain Sequences for d1aua_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aua_1 a.5.3.1 (4-96) N-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae)} qqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfierlddstllrflr arkfdvqlakemfencekwrkdygtdtilqdfh
Timeline for d1aua_1: