Lineage for d1aua_1 (1aua 4-96)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352395Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
    3 helices; bundle, right-handed twist
  4. 352463Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (1 family) (S)
  5. 352464Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins)
  6. 352471Protein N-terminal domain of phosphatidylinositol transfer protein sec14p [46940] (1 species)
  7. 352472Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46941] (1 PDB entry)
  8. 352473Domain d1aua_1: 1aua 4-96 [16290]
    Other proteins in same PDB: d1aua_2
    complexed with bog

Details for d1aua_1

PDB Entry: 1aua (more details), 2.5 Å

PDB Description: phosphatidylinositol transfer protein sec14p from saccharomyces cerevisiae

SCOP Domain Sequences for d1aua_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aua_1 a.5.3.1 (4-96) N-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae)}
qqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfierlddstllrflr
arkfdvqlakemfencekwrkdygtdtilqdfh

SCOP Domain Coordinates for d1aua_1:

Click to download the PDB-style file with coordinates for d1aua_1.
(The format of our PDB-style files is described here.)

Timeline for d1aua_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aua_2