Lineage for d4qwgb_ (4qwg B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2228967Domain d4qwgb_: 4qwg B: [308810]
    Other proteins in same PDB: d4qwga_, d4qwgc_, d4qwge_, d4qwgg_, d4qwgi_, d4qwgj_, d4qwgk_, d4qwgl_, d4qwgn_, d4qwgo_, d4qwgq_, d4qwgs_, d4qwgu_, d4qwgw_, d4qwgx_, d4qwgy_, d4qwgz_
    automated match to d1rypc_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qwgb_

PDB Entry: 4qwg (more details), 2.6 Å

PDB Description: yCP beta5-A49V mutant in complex with carfilzomib
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qwgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwgb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4qwgb_:

Click to download the PDB-style file with coordinates for d4qwgb_.
(The format of our PDB-style files is described here.)

Timeline for d4qwgb_: