Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.4: U2A'-like [52068] (1 protein) duplication: consists of 5-6 partly irregular repeats this is a repeat family; one repeat unit is 1a9n C:89-114 found in domain |
Protein Splicesomal U2A' protein [52069] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52070] (1 PDB entry) |
Domain d1a9nc_: 1a9n C: [30876] Other proteins in same PDB: d1a9nb_, d1a9nd_ protein/RNA complex |
PDB Entry: 1a9n (more details), 2.38 Å
SCOPe Domain Sequences for d1a9nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9nc_ c.10.2.4 (C:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfkgkrgaqlakdia
Timeline for d1a9nc_: