Lineage for d1a9nc_ (1a9n C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21460Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 21488Superfamily c.10.2: L domain-like [52058] (5 families) (S)
  5. 21507Family c.10.2.4: U2A'-like [52068] (1 protein)
    this is a repeat family; one repeat unit is 1a9n C:89-114 found in domain
  6. 21508Protein Splicesomal U2A' protein [52069] (1 species)
  7. 21509Species Human (Homo sapiens) [TaxId:9606] [52070] (1 PDB entry)
  8. 21511Domain d1a9nc_: 1a9n C: [30876]
    Other proteins in same PDB: d1a9nb_, d1a9nd_

Details for d1a9nc_

PDB Entry: 1a9n (more details), 2.38 Å

PDB Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna

SCOP Domain Sequences for d1a9nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9nc_ c.10.2.4 (C:) Splicesomal U2A' protein {Human (Homo sapiens)}
vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil
rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfkgkrgaqlakdia

SCOP Domain Coordinates for d1a9nc_:

Click to download the PDB-style file with coordinates for d1a9nc_.
(The format of our PDB-style files is described here.)

Timeline for d1a9nc_: