SCOPe 2.05: Domain d1a9na_: 1a9n A:

Lineage for d1a9na_ (1a9n A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.4: U2A'-like [52068] (1 protein)
   duplication: consists of 5-6 partly irregular repeats
   this is a repeat family; one repeat unit is 1a9n C:89-114 found in domain

6. Protein Splicesomal U2A' protein [52069] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52070] (1 PDB entry)

8. Domain d1a9na_: 1a9n A: [30875]
   Other proteins in same PDB: d1a9nb_, d1a9nd_
   protein/RNA complex

Details for d1a9na_

PDB Entry: 1a9n, 2.38 Å

PDB Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna

PDB Compounds: (A:) u2a'

SCOPe Domain Sequences for d1a9na_:

Sequence; same for both SEQRES and ATOM records:

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}
vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil
rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfk

Timeline for d1a9na_:

• d1a9na_ first appeared (with stable ids) in SCOP 1.55
  
• d1a9na_ appears in SCOPe 2.04
  
• d1a9na_ appears in SCOPe 2.06
  
• d1a9na_ appears in the current release, SCOPe 2.08