Lineage for d4qw5a_ (4qw5 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2225538Domain d4qw5a_: 4qw5 A: [308713]
    Other proteins in same PDB: d4qw5b_, d4qw5c_, d4qw5f_, d4qw5g_, d4qw5h_, d4qw5m_, d4qw5p_, d4qw5q_, d4qw5t_, d4qw5u_, d4qw5v_
    automated match to d1rypb_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qw5a_

PDB Entry: 4qw5 (more details), 3 Å

PDB Description: yCP beta5-M45A mutant in complex with carfilzomib
PDB Compounds: (A:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d4qw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qw5a_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d4qw5a_:

Click to download the PDB-style file with coordinates for d4qw5a_.
(The format of our PDB-style files is described here.)

Timeline for d4qw5a_: