Lineage for d4qvql_ (4qvq L:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2226421Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2226430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2226953Domain d4qvql_: 4qvq L: [308531]
    Other proteins in same PDB: d4qvqb_, d4qvqc_, d4qvqe_, d4qvqf_, d4qvqg_, d4qvqh_, d4qvqk_, d4qvqm_, d4qvqp_, d4qvqq_, d4qvqs_, d4qvqt_, d4qvqu_, d4qvqv_, d4qvqy_
    automated match to d1rypm_
    complexed with bo2, cl, mg; mutant

Details for d4qvql_

PDB Entry: 4qvq (more details), 2.6 Å

PDB Description: yCP beta5-M45I mutant in complex with bortezomib
PDB Compounds: (L:) Proteasome subunit beta type-6

SCOPe Domain Sequences for d4qvql_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvql_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d4qvql_:

Click to download the PDB-style file with coordinates for d4qvql_.
(The format of our PDB-style files is described here.)

Timeline for d4qvql_: