Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d4qvpm_: 4qvp M: [308508] Other proteins in same PDB: d4qvpa_, d4qvpc_, d4qvpe_, d4qvpg_, d4qvpi_, d4qvpj_, d4qvpk_, d4qvpl_, d4qvpn_, d4qvpo_, d4qvpq_, d4qvps_, d4qvpu_, d4qvpw_, d4qvpx_, d4qvpy_, d4qvpz_ automated match to d4j70m_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qvp (more details), 2.3 Å
SCOPe Domain Sequences for d4qvpm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qvpm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d4qvpm_: