Lineage for d4quxp_ (4qux P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993902Domain d4quxp_: 4qux P: [308175]
    Other proteins in same PDB: d4quxa_, d4quxc1, d4quxc2, d4quxe_, d4quxi_, d4quxj_, d4quxk_, d4quxl_, d4quxn_, d4quxo_, d4quxq1, d4quxq2, d4quxs_, d4quxw_, d4quxx_, d4quxy_, d4quxz_
    automated match to d1rypc_
    complexed with mg; mutant

Details for d4quxp_

PDB Entry: 4qux (more details), 3 Å

PDB Description: yCP beta5-A49T-mutant
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4quxp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4quxp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4quxp_:

Click to download the PDB-style file with coordinates for d4quxp_.
(The format of our PDB-style files is described here.)

Timeline for d4quxp_: