Lineage for d4ll6a_ (4ll6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008039Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2008040Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2008071Protein automated matches [310888] (2 species)
    not a true protein
  7. 2008072Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311398] (1 PDB entry)
  8. 2008073Domain d4ll6a_: 4ll6 A: [307686]
    automated match to d3mmib_
    complexed with acy

Details for d4ll6a_

PDB Entry: 4ll6 (more details), 2.3 Å

PDB Description: Structure of Myo4p globular tail domain.
PDB Compounds: (A:) Myosin-4

SCOPe Domain Sequences for d4ll6a_:

Sequence, based on SEQRES records: (download)

>d4ll6a_ a.118.27.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pdllellmdlncytlevtegylkkvnvtevngdnvlgpihvittvvsslvrnglliqssk
fiskvlltvesivmslpkdetmlggifwlsnlsrlpafaanqktlyeanggdekdkltli
ylndlenetlkvfdkiystwlvkfmkhasahieifdmvlneklfknsgdekfaklftfln
efdavlckfqvvdsmhtkifndtlkylnvmlfndlitkcpalnwkygyevdrnierlvsw
fepriedvrpnliqiiqavkilqlnisnlnefkllfdfwyalnpaqiqaillkykpankg
eagvpneilnylanvikrenlslpgkmeimlsaqfdsaknhlrydtsaitqnsnteglat
vskii

Sequence, based on observed residues (ATOM records): (download)

>d4ll6a_ a.118.27.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pdllellmdlncytlevtegylkkvnvtevndnvlgpihvittvvsslvrnglliqsskf
iskvlltvesivmslpkdetmlggifwlsnlsrlpafaanqktlyeagdekdkltliyln
dlenetlkvfdkiystwlvkfmkhasahieifdmvlneklfkngdekfaklftflnefda
vlckfqvvdsmhtkifndtlkylnvmlfndlitkcpalnwkygyevdrnierlvswfepr
iedvrpnliqiiqavkilqlnisnfkllfdfwyalnpaqiqaillkykpankgeagvpne
ilnylanvikrenpgkmeimlsaqfdsaknhlrydteglatvskii

SCOPe Domain Coordinates for d4ll6a_:

Click to download the PDB-style file with coordinates for d4ll6a_.
(The format of our PDB-style files is described here.)

Timeline for d4ll6a_:

  • d4ll6a_ is new in SCOPe 2.06-stable