Lineage for d4jnca1 (4jnc A:238-548)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151394Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 2151408Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)
  7. 2151409Species Human (Homo sapiens) [TaxId:9606] [102626] (40 PDB entries)
  8. 2151410Domain d4jnca1: 4jnc A:238-548 [307608]
    Other proteins in same PDB: d4jnca2
    automated match to d4c4xa_
    complexed with 1lf

Details for d4jnca1

PDB Entry: 4jnc (more details), 1.96 Å

PDB Description: soluble epoxide hydrolase complexed with a carboxamide inhibitor
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d4jnca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jnca1 c.69.1.11 (A:238-548) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
shgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgyg
essappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravas
lntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvl
smhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwac
kslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqi
likwldsdarn

SCOPe Domain Coordinates for d4jnca1:

Click to download the PDB-style file with coordinates for d4jnca1.
(The format of our PDB-style files is described here.)

Timeline for d4jnca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jnca2