SCOPe 2.07: Domain d4jnca1: 4jnc A:238-548

Lineage for d4jnca1 (4jnc A:238-548)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)

6. Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102626] (41 PDB entries)

8. Domain d4jnca1: 4jnc A:238-548 [307608]
   Other proteins in same PDB: d4jnca2
   automated match to d4c4xa_
   complexed with 1lf

Details for d4jnca1

PDB Entry: 4jnc, 1.96 Å

PDB Description: soluble epoxide hydrolase complexed with a carboxamide inhibitor

PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d4jnca1:

Sequence; same for both SEQRES and ATOM records:

>d4jnca1 c.69.1.11 (A:238-548) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
shgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgyg
essappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravas
lntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvl
smhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwac
kslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqi
likwldsdarn

Timeline for d4jnca1:

• d4jnca1 first appeared in SCOPe 2.06
  
• d4jnca1 appears in the current release, SCOPe 2.08