SCOPe 2.07: Domain d4d7sb_: 4d7s B:

Lineage for d4d7sb_ (4d7s B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (18 species)
   not a true protein

7. Species Spirochaeta thermophila [TaxId:665571] [311368] (2 PDB entries)

8. Domain d4d7sb_: 4d7s B: [307243]
   automated match to d2ptma_
   complexed with pcg

Details for d4d7sb_

PDB Entry: 4d7s, 2.55 Å

PDB Description: structure of the sthk carboxy-terminal region in complex with cgmp

PDB Compounds: (B:) sthk_cnbd_cgmp

SCOPe Domain Sequences for d4d7sb_:

Sequence; same for both SEQRES and ATOM records:

>d4d7sb_ b.82.3.0 (B:) automated matches {Spirochaeta thermophila [TaxId: 665571]}
hrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrlavamei
hgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgsvevlsa
dektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsrypeiaaqi
qelavrrkeel

Timeline for d4d7sb_:

• d4d7sb_ first appeared in SCOPe 2.06
  
• d4d7sb_ appears in the current release, SCOPe 2.08