SCOPe 2.06: Domain d4crha1: 4crh A:18-120

Lineage for d4crha1 (4crh A:18-120)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries)

8. Domain d4crha1: 4crh A:18-120 [307160]
   Other proteins in same PDB: d4crha2
   automated match to d5bxde_

Details for d4crha1

PDB Entry: 4crh, 1.72 Å

PDB Description: crystal structure of the btb-t1 domain of human shkbp1

PDB Compounds: (A:) sh3kbp1-binding protein 1

SCOPe Domain Sequences for d4crha1:

Sequence, based on SEQRES records:

>d4crha1 d.42.1.0 (A:18-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gevihlnvggkrfstsrqtltwipdsffssllsgristlkdetgaifidrdptvfapiln
flrtkeldprgvhgssllheaqfygltplvrrlqlreeldrss

Sequence, based on observed residues (ATOM records):

>d4crha1 d.42.1.0 (A:18-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gevihlnvggkrfstsrqtltwipdsffssllstlkdetgaifidrdptvfapilnflrt
keldssllheaqfygltplvrrlqlreeldrss

Timeline for d4crha1:

• d4crha1 is new in SCOPe 2.06-stable
  
• d4crha1 appears in SCOPe 2.07
  
• d4crha1 appears in the current release, SCOPe 2.08