Lineage for d4crha1 (4crh A:18-120)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513558Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2513559Protein automated matches [190710] (3 species)
    not a true protein
  7. 2513560Species Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries)
  8. 2513584Domain d4crha1: 4crh A:18-120 [307160]
    Other proteins in same PDB: d4crha2
    automated match to d5bxde_

Details for d4crha1

PDB Entry: 4crh (more details), 1.72 Å

PDB Description: crystal structure of the btb-t1 domain of human shkbp1
PDB Compounds: (A:) sh3kbp1-binding protein 1

SCOPe Domain Sequences for d4crha1:

Sequence, based on SEQRES records: (download)

>d4crha1 d.42.1.0 (A:18-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gevihlnvggkrfstsrqtltwipdsffssllsgristlkdetgaifidrdptvfapiln
flrtkeldprgvhgssllheaqfygltplvrrlqlreeldrss

Sequence, based on observed residues (ATOM records): (download)

>d4crha1 d.42.1.0 (A:18-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gevihlnvggkrfstsrqtltwipdsffssllstlkdetgaifidrdptvfapilnflrt
keldssllheaqfygltplvrrlqlreeldrss

SCOPe Domain Coordinates for d4crha1:

Click to download the PDB-style file with coordinates for d4crha1.
(The format of our PDB-style files is described here.)

Timeline for d4crha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4crha2