SCOP 1.63: Domain d1ezc_2: 1ezc 1-21,145-259

Lineage for d1ezc_2 (1ezc 1-21,145-259)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (6 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in all proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (2 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)

6. Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)
   contains 4-helical insert domain, residues 22-144

7. Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)

8. Domain d1ezc_2: 1ezc 1-21,145-259 [30713]
   Other proteins in same PDB: d1ezc_1

Details for d1ezc_2

PDB Entry: 1ezc

PDB Description: amino terminal domain of enzyme i from escherichia coli, nmr, 17 structures

SCOP Domain Sequences for d1ezc_2:

Sequence; same for both SEQRES and ATOM records:

>d1ezc_2 c.8.1.2 (1-21,145-259) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli}
misgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitd
aggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmrav
qeqvasekaelaklkdr

Timeline for d1ezc_2:

• d1ezc_2 first appeared (with stable ids) in SCOP 1.55
  
• d1ezc_2 appears in SCOP 1.61
  
• d1ezc_2 appears in SCOP 1.65
  
• d1ezc_2 appears in the current release, SCOPe 2.08, called d1ezca2