| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) ![]() |
| Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein) |
| Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species) |
| Species Escherichia coli [TaxId:562] [52015] (11 PDB entries) |
| Domain d1ezc_2: 1ezc 1-21,145-259 [30713] Other proteins in same PDB: d1ezc_1 |
PDB Entry: 1ezc (more details)
SCOP Domain Sequences for d1ezc_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezc_2 c.8.1.2 (1-21,145-259) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli}
misgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitd
aggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmrav
qeqvasekaelaklkdr
Timeline for d1ezc_2: