SCOP 1.61: Domain d1zymb2: 1zym B:2-21,B:145-249

Lineage for d1zymb2 (1zym B:2-21,B:145-249)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)

4. Superfamily c.8.1: Phosphohistidine domain [52009] (2 families)

5. Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)

6. Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)

7. Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)

8. Domain d1zymb2: 1zym B:2-21,B:145-249 [30706]
   Other proteins in same PDB: d1zyma1, d1zymb1

Details for d1zymb2

PDB Entry: 1zym, 2.5 Å

PDB Description: amino terminal domain of enzyme i from escherichia coli

SCOP Domain Sequences for d1zymb2:

Sequence; same for both SEQRES and ATOM records:

>d1zymb2 c.8.1.2 (B:2-21,B:145-249) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli}
isgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitda
ggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmravq
eqvase

Timeline for d1zymb2:

• d1zymb2 first appeared (with stable ids) in SCOP 1.55
  
• d1zymb2 appears in SCOP 1.59
  
• d1zymb2 appears in SCOP 1.63
  
• d1zymb2 appears in the current release, SCOPe 2.08