Lineage for d1zymb2 (1zym B:2-21,B:145-249)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119570Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 119571Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) (S)
  5. 119581Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)
  6. 119582Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)
  7. 119583Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)
  8. 119585Domain d1zymb2: 1zym B:2-21,B:145-249 [30706]
    Other proteins in same PDB: d1zyma1, d1zymb1

Details for d1zymb2

PDB Entry: 1zym (more details), 2.5 Å

PDB Description: amino terminal domain of enzyme i from escherichia coli

SCOP Domain Sequences for d1zymb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zymb2 c.8.1.2 (B:2-21,B:145-249) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli}
isgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitda
ggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmravq
eqvase

SCOP Domain Coordinates for d1zymb2:

Click to download the PDB-style file with coordinates for d1zymb2.
(The format of our PDB-style files is described here.)

Timeline for d1zymb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zymb1