Lineage for d2r1rc2 (2r1r C:222-737)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583106Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 1583107Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (5 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 1583133Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein)
    automatically mapped to Pfam PF02867
  6. 1583134Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species)
  7. 1583135Species Escherichia coli [TaxId:562] [52004] (8 PDB entries)
  8. 1583151Domain d2r1rc2: 2r1r C:222-737 [30697]
    Other proteins in same PDB: d2r1ra1, d2r1rb1, d2r1rc1
    complexed with ttp

Details for d2r1rc2

PDB Entry: 2r1r (more details), 3 Å

PDB Description: ribonucleotide reductase r1 protein with dttp occupying the specificity site from escherichia coli
PDB Compounds: (C:) ribonucleotide reductase r1 protein

SCOPe Domain Sequences for d2r1rc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1rc2 c.7.1.2 (C:222-737) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]}
fsscvliecgdsldsinatssaivkyvsqragiginagriralgspirggeafhtgcipf
ykhfqtavkscsqggvrggaatlfypmwhlevesllvlknnrgvegnrvrhmdygvqink
lmytrllkgeditlfspsdvpglydaffadqeeferlytkyekddsirkqrvkavelfsl
mmqerastgriyiqnvdhcnthspfdpaiapvrqsnlcleialptkplndvndengeial
ctlsafnlgainnldeleelailavraldalldyqdypipaakrgamgrrtlgigvinfa
yylakhgkrysdgsannlthktfeaiqyyllkasnelakeqgacpwfnettyakgilpid
tykkdldtianeplhydwealresikthglrnstlsalmpsetssqisnatngiepprgy
vsikaskdgilrqvvpdyehlhdayellwempgndgylqlvgimqkfidqsisantnydp
srfpsgkvpmqqllkdlltaykfgvktlyyqntrdg

SCOPe Domain Coordinates for d2r1rc2:

Click to download the PDB-style file with coordinates for d2r1rc2.
(The format of our PDB-style files is described here.)

Timeline for d2r1rc2: