Lineage for d2r1rc1 (2r1r C:5-221)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1497944Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 1497945Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 1497946Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 1497947Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 1497948Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)
    Uniprot Q08698
  8. 1497964Domain d2r1rc1: 2r1r C:5-221 [18771]
    Other proteins in same PDB: d2r1ra2, d2r1rb2, d2r1rc2
    complexed with ttp

Details for d2r1rc1

PDB Entry: 2r1r (more details), 3 Å

PDB Description: ribonucleotide reductase r1 protein with dttp occupying the specificity site from escherichia coli
PDB Compounds: (C:) ribonucleotide reductase r1 protein

SCOPe Domain Sequences for d2r1rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1rc1 a.98.1.1 (C:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq

SCOPe Domain Coordinates for d2r1rc1:

Click to download the PDB-style file with coordinates for d2r1rc1.
(The format of our PDB-style files is described here.)

Timeline for d2r1rc1: