Lineage for d3wxgb_ (3wxg B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931514Protein Ubiquitin [54238] (9 species)
  7. 2932306Species Mouse (Mus musculus) [TaxId:10090] [190020] (15 PDB entries)
  8. 2932342Domain d3wxgb_: 3wxg B: [306931]
    automated match to d3wwqa_

Details for d3wxgb_

PDB Entry: 3wxg (more details), 3.1 Å

PDB Description: crystal structure of cyld usp domain (c596a) in complex with lys63- linked diubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d3wxgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxgb_ d.15.1.1 (B:) Ubiquitin {Mouse (Mus musculus) [TaxId: 10090]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d3wxgb_:

Click to download the PDB-style file with coordinates for d3wxgb_.
(The format of our PDB-style files is described here.)

Timeline for d3wxgb_: