![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (5 proteins) Pfam PF16863 |
![]() | Protein Maltase, N-terminal domain [310749] (2 species) |
![]() | Species Beta vulgaris [TaxId:161934] [311004] (6 PDB entries) |
![]() | Domain d3wena1: 3wen A:40-299 [306741] Other proteins in same PDB: d3wena2, d3wena3, d3wena4 automated match to d3w38a1 complexed with nag, so4 |
PDB Entry: 3wen (more details), 2.59 Å
SCOPe Domain Sequences for d3wena1:
Sequence, based on SEQRES records: (download)
>d3wena1 b.30.5.11 (A:40-299) Maltase, N-terminal domain {Beta vulgaris [TaxId: 161934]} aigygyqvknakvdnstgksltallqlirnspvygpdiqflsftasfeeddtlriritda nnrrweipnevlprpppppsppplsslqhlpkpipqnqptttvlshphsdlvftlfhttp fgftiyrksthdvlfdatpipsnpttfliykdqylqlssslpaqqahlyglgehtkptfq lahnqiltlwnadiasfnrdlnlygshpfymdvrsspmvgsthgvfllnsngmdveytgd ritykviggiidlyifagrt
>d3wena1 b.30.5.11 (A:40-299) Maltase, N-terminal domain {Beta vulgaris [TaxId: 161934]} aigygyqvknakvdnstgksltallqlirnspvygpdiqflsftasfeeddtlriritda nnrrweipnevlprpppppspppqptttvlshphsdlvftlfhttpfgftiyrksthdvl fdatpipsnpttfliykdqylqlssslpaqqahlyglgehtkptfqlahnqiltlwnadi asfnrdlnlygshpfymdvrsspmvgsthgvfllnsngmdveytgdritykviggiidly ifagrt
Timeline for d3wena1: