Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins) |
Protein Maltase, domain 3 [310753] (2 species) |
Species Beta vulgaris [TaxId:161934] [311008] (6 PDB entries) |
Domain d3wena3: 3wen A:673-756 [306743] Other proteins in same PDB: d3wena1, d3wena2, d3wena4 automated match to d3w38a3 complexed with nag, so4 |
PDB Entry: 3wen (more details), 2.59 Å
SCOPe Domain Sequences for d3wena3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wena3 b.71.1.4 (A:673-756) Maltase, domain 3 {Beta vulgaris [TaxId: 161934]} piarplfftfpddvatygissqfligrgimvspvlqpgavsvnayfprgnwfslfnytss vsvsagtyvslsappdhinvhihe
Timeline for d3wena3: