PDB entry 3wen

View 3wen on RCSB PDB site
Description: Sugar beet alpha-glucosidase with acarviosyl-maltopentaose
Class: hydrolase
Keywords: alpha-glucosidase, glycoside hydrolase family 31, (beta/alpha)8-barrel, acarbose derivative, HYDROLASE
Deposited on 2013-07-09, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.202
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wenA (A:)
    mersklpryicatlavvlplvlcmvvegattskndnqgeaigygyqvknakvdnstgksl
    tallqlirnspvygpdiqflsftasfeeddtlriritdannrrweipnevlprpppppsp
    pplsslqhlpkpipqnqptttvlshphsdlvftlfhttpfgftiyrksthdvlfdatpip
    snpttfliykdqylqlssslpaqqahlyglgehtkptfqlahnqiltlwnadiasfnrdl
    nlygshpfymdvrsspmvgsthgvfllnsngmdveytgdritykviggiidlyifagrtp
    emvldqytkligrpapmpywafgfhqcrwgyrdvneietvvdkyaeariplevmwtdidy
    mdafkdftldpvhfpldkmqqfvtklhrngqryvpildpgintnksygtfirgmqsnvfi
    krdgnpylgsvwpgpvyypdfldpaarsfwvdeikrfrdilpidgiwidmneasnfitsa
    ptpgstldnppykinnsggrvpinsktipatamhygnvteynahnlygflesqatrealv
    rtsnerpfllsrstfagsgkytahwtgdnaarwddlqysiptmlnfglfgmpmigadicg
    faestteelcrrwiqlgafypfsrdhsardtthqelylwesvaasartvlglryqllpyy
    ytlmydanlrgipiarplfftfpddvatygissqfligrgimvspvlqpgavsvnayfpr
    gnwfslfnytssvsvsagtyvslsappdhinvhihegnivamqgeamttqaarstpfhll
    vvmsdhvastgelfldngiemdiggpggkwtlvrffaesginnltissevvnrgyamsqr
    wvmdkitilglkrrvrikeytvqkdagaikikglglrtsshnqggfvvsvisdlrqlvgq
    afklelefegatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wenA (A:)
    aigygyqvknakvdnstgksltallqlirnspvygpdiqflsftasfeeddtlriritda
    nnrrweipnevlprpppppspppqptttvlshphsdlvftlfhttpfgftiyrksthdvl
    fdatpipsnpttfliykdqylqlssslpaqqahlyglgehtkptfqlahnqiltlwnadi
    asfnrdlnlygshpfymdvrsspmvgsthgvfllnsngmdveytgdritykviggiidly
    ifagrtpemvldqytkligrpapmpywafgfhqcrwgyrdvneietvvdkyaeariplev
    mwtdidymdafkdftldpvhfpldkmqqfvtklhrngqryvpildpgintnksygtfirg
    mqsnvfikrdgnpylgsvwpgpvyypdfldpaarsfwvdeikrfrdilpidgiwidmnea
    snfitsaptpgstldnppykinnsggrvpinsktipatamhygnvteynahnlygflesq
    atrealvrtsnerpfllsrstfagsgkytahwtgdnaarwddlqysiptmlnfglfgmpm
    igadicgfaestteelcrrwiqlgafypfsrdhsardtthqelylwesvaasartvlglr
    yqllpyyytlmydanlrgipiarplfftfpddvatygissqfligrgimvspvlqpgavs
    vnayfprgnwfslfnytssvsvsagtyvslsappdhinvhihegnivamqgeamttqaar
    stpfhllvvmsdhvastgelfldngiemdiggpggkwtlvrffaesginnltissevvnr
    gyamsqrwvmdkitilglkrrvrikgfvvsvisdlrqlvgqafklelefe