SCOP 1.71: Domain d1uag_1: 1uag 1-93

Lineage for d1uag_1 (1uag 1-93)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group

4. Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family)

5. Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)

6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)

7. Species Escherichia coli [TaxId:562] [51987] (6 PDB entries)

8. Domain d1uag_1: 1uag 1-93 [30653]
   Other proteins in same PDB: d1uag_2, d1uag_3
   complexed with so4, uma

Details for d1uag_1

PDB Entry: 1uag, 1.95 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d1uag_1:

Sequence; same for both SEQRES and ATOM records:

>d1uag_1 c.5.1.1 (1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

Timeline for d1uag_1:

• d1uag_1 first appeared (with stable ids) in SCOP 1.55
  
• d1uag_1 appears in SCOP 1.69
  
• d1uag_1 is called d1uaga1 in SCOP 1.73
  
• d1uag_1 appears in the current release, SCOPe 2.08, called d1uaga1