Lineage for d1uag_1 (1uag 1-93)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 479572Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 479573Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) (S)
  5. 479574Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 479587Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)
  7. 479588Species Escherichia coli [TaxId:562] [51987] (6 PDB entries)
  8. 479592Domain d1uag_1: 1uag 1-93 [30653]
    Other proteins in same PDB: d1uag_2, d1uag_3

Details for d1uag_1

PDB Entry: 1uag (more details), 1.95 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d1uag_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uag_1 c.5.1.1 (1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOP Domain Coordinates for d1uag_1:

Click to download the PDB-style file with coordinates for d1uag_1.
(The format of our PDB-style files is described here.)

Timeline for d1uag_1: