| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) ![]() |
| Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins) |
| Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species) |
| Species Escherichia coli [TaxId:562] [51987] (6 PDB entries) |
| Domain d1uag_1: 1uag 1-93 [30653] Other proteins in same PDB: d1uag_2, d1uag_3 |
PDB Entry: 1uag (more details), 1.95 Å
SCOP Domain Sequences for d1uag_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uag_1 c.5.1.1 (1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg
Timeline for d1uag_1: