Lineage for d1uag_2 (1uag 298-437)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588053Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 588054Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 588055Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 588072Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)
  7. 588073Species Escherichia coli [TaxId:562] [53247] (6 PDB entries)
  8. 588077Domain d1uag_2: 1uag 298-437 [33954]
    Other proteins in same PDB: d1uag_1, d1uag_3
    complexed with so4, uma

Details for d1uag_2

PDB Entry: 1uag (more details), 1.95 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d1uag_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uag_2 c.59.1.1 (298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOP Domain Coordinates for d1uag_2:

Click to download the PDB-style file with coordinates for d1uag_2.
(The format of our PDB-style files is described here.)

Timeline for d1uag_2: