Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries) |
Domain d3qkfe1: 3qkf E:4-113 [306373] Other proteins in same PDB: d3qkfa2, d3qkfa3, d3qkfb2, d3qkfb3, d3qkfc2, d3qkfc3, d3qkfd2, d3qkfd3, d3qkfe2, d3qkfe3, d3qkff2, d3qkff3, d3qkfg2, d3qkfg3, d3qkfh2, d3qkfh3 automated match to d3thua1 complexed with gco, mg; mutant |
PDB Entry: 3qkf (more details), 1.45 Å
SCOPe Domain Sequences for d3qkfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qkfe1 d.54.1.0 (E:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]} kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d3qkfe1: