Lineage for d3qkfe2 (3qkf E:114-405)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099417Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2099418Protein automated matches [226923] (74 species)
    not a true protein
  7. 2099539Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries)
  8. 2099560Domain d3qkfe2: 3qkf E:114-405 [306374]
    Other proteins in same PDB: d3qkfa1, d3qkfa3, d3qkfb1, d3qkfb3, d3qkfc1, d3qkfc3, d3qkfd1, d3qkfd3, d3qkfe1, d3qkfe3, d3qkff1, d3qkff3, d3qkfg1, d3qkfg3, d3qkfh1, d3qkfh3
    automated match to d3thua2
    complexed with gco, mg; mutant

Details for d3qkfe2

PDB Entry: 3qkf (more details), 1.45 Å

PDB Description: Crystal structure of the mutant P317A of D-mannonate dehydratase from Chromohalobacter Salexigens complexed with Mg and D-Gluconate
PDB Compounds: (E:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3qkfe2:

Sequence, based on SEQRES records: (download)

>d3qkfe2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records): (download)

>d3qkfe2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvslpaehvwst
ekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaen
qeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlas
lyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghfl
agespghgvdideelaakypyeraslpvnrledgtlwhw

SCOPe Domain Coordinates for d3qkfe2:

Click to download the PDB-style file with coordinates for d3qkfe2.
(The format of our PDB-style files is described here.)

Timeline for d3qkfe2: