Lineage for d3q9bh_ (3q9b H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2606087Protein automated matches [190420] (9 species)
    not a true protein
  7. 2606125Species Momordica balsamina [TaxId:3672] [189375] (73 PDB entries)
  8. 2606184Domain d3q9bh_: 3q9b H: [306292]
    automated match to d4zuoa_
    complexed with b3n, dms, k, na, zn

Details for d3q9bh_

PDB Entry: 3q9b (more details), 2.25 Å

PDB Description: Crystal Structure of APAH complexed with M344
PDB Compounds: (H:) Acetylpolyamine amidohydrolase

SCOPe Domain Sequences for d3q9bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q9bh_ d.165.1.1 (H:) automated matches {Momordica balsamina [TaxId: 3672]}
mrvifsedhklrnaktelyggelvppfeapfraewilaavkeagfddvvaparhgletvl
kvhdagylnfletawdrwkaagykgeaiatsfpvrrtspriptdiegqigyycnaaetai
spgtweaalssmasaidgadliaaghkaafslcrppghhagidmfggycfinnaavaaqr
lldkgakkiaildvdfhhgngtqdifyergdvffaslhgdpaeafphflgyaeetgkgag
agttanypmgrgtpysvwgealtdslkriaafgaeaivvslgvdtfeqdpisffkltspd
yitmgrtiaasgvpllvvmeggygvpeiglnvanvlkgvag

SCOPe Domain Coordinates for d3q9bh_:

Click to download the PDB-style file with coordinates for d3q9bh_.
(The format of our PDB-style files is described here.)

Timeline for d3q9bh_: